123424
APOC4 (Apolipoprotein C-IV, Apo-CIV, ApoC-IV, Apolipoprotein C4)
Size
£760.00
- SKU:
- 123424
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full-length protein corresponding to aa1-127 from human APOC4 (NP_001637.1)
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Apolipoprotein C4 is a member of the apolipoprotein family. The gene encoding APOC4 is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice