123423
APOC3 (Apolipoprotein C-III, Apo-CIII, ApoC-III, Apolipoprotein C3)
Size
£685.00
- SKU:
- 123423
- Purity:
- Purified by Protein A affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa21-99 from human APOC3 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 8H7
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Apolipoprotein C-III (Apo CIII) is one of 9 known polymorphic forms of apolipoproteins. The apolipoproteins functions as stabilizer of the intact lipoprotein particles. Specifically, Apo CIII is a very low density lipoprotein (VLDL) protein. Apo CIII is involved inhibition of lipoprotein lipase and hepatic lipase. It is thought to delay catabolism of triglyceride-rich particles. A defect in Apo CIII has been linked to cause of hyperalphalipoproteinemia (HLAP), which causes increase levels of high density lipoprotein (HDL). Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml HeLa cells Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice