APOBEC3H (Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 3H, ARP10, DJ742C19.2)

Size

£685.00

SKU:: 123419
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human APOBEC3H, aa1-182 (AAH69023.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: DNA dC->dU-editing Enzyme APOBEC-3H, APOBEC-related Protein 10, ARP-10, Apolipoprotein B mRNA-editing Enzyme Catalytic Polypeptide-like 3H Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.