APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2)

Size

£760.00

SKU:: 123406
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human APOA2, aa1-100 (NP_001634.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Apolipoprotein A2 (ApoA2) is a major protein component of serum HDL. It is produced by the liver and is involved in cholesteryl ester formation and cholesterol transport from tissues to the liver. Polymorphisms of ApoA2 are associated with disorders of cholesterol and fatty acid metabolism. ApoA2 can form disulfide-linked 17kD homodimers and heterodimers with other apolipoproteins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.