API5 (Apoptosis Inhibitor 5, API 5, API-5, Antiapoptosis Clone 11 Protein, AAC11, AAC-11, API5-like 1, API5L1, Cell Migration-inducing Gene 8 Protein, Fibroblast Growth Factor 2-interacting Factor 2, FIF, MIG8, Migration Inducing Protein MIG8, Protein XAGL)

Size

£685.00

SKU:: 123400
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa400-504 from API5 (AAH17709) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Antiapoptotic factor that may have a role in protein assembly. Negatively regulates ACIN1. By binding to ACIN1, it suppresses ACIN1 cleavage from CASP3 and ACIN1-mediated DNA fragmentation. Also known to efficiently suppress E2F1-induced apoptosis. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Applications: Suitable for use in ELISA, Immunofluorescence, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.