AP4B1 (AP-4 Complex Subunit beta-1, AP-4 Adapter Complex Subunit beta, Adapter-related Protein Complex 4 Subunit beta-1, Beta Subunit of AP-4, Beta4-adaptin)

Size

£685.00

SKU:: 123383
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa640-739 from human AP4B1 (NP_006585) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.