AP1S2 (AP-1 Complex Subunit sigma-2, Adapter-related Protein Complex 1 sigma-1B Subunit, Adaptor Protein Complex AP-1 sigma-1B Subunit, Clathrin Assembly Protein Complex 1 sigma-1B Small Chain, Golgi Adaptor HA1/AP1 Adaptin sigma-1B Subunit, Sigma 1B Subunit of AP-1 Clathrin, Sigma-adaptin 1B, Sigma1B-adaptin, DC22)

Size

£685.00

SKU:: 123378
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-158 from human AP1S2 (AAH01117) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B9-G5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.