123322-HRP

ANGPTL4 (Angiopoietin-related Protein 4, Angiopoietin-like Protein 4, Hepatic Fibrinogen/Angiopoietin-related Protein, HFARP, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197) (HRP)

Size

£914.00

SKU:: 123322-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa26-406 from human ANGPTL4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Angiopoietin-like protein 4 (ANGPTL4), also known as PPAR angiopoietinrelated protein, fasting-induced adipose factor, or hepatic fibrinogen /angiopoietin-related protein (HFARP), is a secreted adipokine predominantly expressed in adipose tissue and liver. The experimental results show that ANGPTL4 is a blood-borne hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. Serum levels of ANGPTL4 were decreased in patients with type 2 diabetes. In animal experiments, ANGPTL4 treatments might reduce hyperglycemia, and improve glucose tolerance by decreasing hepatic glucose production and enhancing insulin-mediated inhibition of gluconeogenesis. However, the molecular mechanisms underlying its metabolic actions remain elusive. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYHPLQATTMLIQPIAAEAAS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice