123280
AMELX (Amelogenin, X Isoform, AMG, AMGX)
Size
£685.00
- SKU:
- 123280
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human AMELX, aa1-191 (NP_001133.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Amelx (amelogenin X chromosome) is an extracellular matrix protein secreted by ameloblasts and is a major component of enamel matrix. The Amelogenin plays a role in the biomineralization of teeth. It seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. The protein is also thought to play a major role in the structural organization and mineralization of developing enamel. Recently, in addition to their role in enamel formation, the biological activity of enamel proteins in the process of cell differentiation has recently become widely appreciated. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice