123273-BIOTIN
AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (Biotin)
Size
£927.00
- SKU:
- 123273-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length recombinant protein corresponding to aa1-198 from human AMACR with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Alpha-methyacyl-CoA racemase (AMCR), is an enzyme invloved in beta oxidation of branched chain fatty acids and bile salt intermediates, and has recently been identified as a neomarker for prostate cancer, where it is over expressed. Several different isoforms have been reported that are produced either by extensinve alternatve splicing of 5 exons or by use of alternate initiation codons. At least 2 different transcripts, each derived from the 5 exons, have been reported, AMCR I and AMCR II. AMCR I is the most abundant form and enclodes for a 382aa protein (42kD). The other isoform AMCR II exhibits significant homolgy to fumarate hydratase and encodes a 288aa protein (32kD). Several other variants of IA and IIA isoforms have been characterized recently. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice