123269-ML490
ALS2CR2 (STE20-related Kinase Adapter Protein beta, STRAD beta, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 2 Protein, CALS-21, ILP-interacting Protein, Pseudokinase ALS2CR2, STRADB, ILPIP, PRO1038) (MaxLight 490)
Size
£914.00
- SKU:
- 123269-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa319-418 from human ALS2CR2 (AAH08302) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3E11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. ALS2CR2, a novel anti-apoptotic protein, belongs to the serine/threonine protein kinase STE20 subfamily. Due to the presence of a protein kinase domain with one of the active site residues altered, ALS2CR2 is known as pseudokinase. ALS2CR2 is a component of a complex involved in the activation of a master kinase serine/threonine kinase 11, that regulates cell polarity and energy-generating metabolism and is known to regulate the relocation of this kinase from the nucleus to the cytoplasm. It is essential for G1 cell cycle arrest mediated by this kinase. ALS2CR2 is known to interact with the X chromosome-linked inhibitor of apoptosis protein, and thus enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice