ALDH1L1 (Aldehyde Dehydrogenase Family 1 Member L1, 10-formyltetrahydrofolate Dehydrogenase, 10-FTHFDH, FTHFD, DKFZp781N0997)

Size

£685.00

SKU:: 123198
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do not freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa803-902 from human ALDH1L1 (NM_012190, NP_036322) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.