AKR1C2 (Aldo-keto Reductase Family 1 Member C2, 3-alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-binding Protein, DD/BABP, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, Type III 3-alpha-hydroxysteroid Dehydrogenase, DDH2)

Size

£685.00

SKU:: 123162
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa224-323 from human AKR1C2 (AAH63574) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: AKR1C2 is a member of the aldo-oxo reductase (AKR) superfamily. It catalyzes the NADP-linked oxidation of trans-dihydrodiols of aromatic hydrocarbons to corresponding catechols. AKR1C2 works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. It catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). AKR1C2 has a high bile-binding ability. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.3ng/ml as a capture antibody. Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice