AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, DDH, DDH1) (Not for Export EU)

Size

£760.00

SKU:: 123157
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human AKR1C1, aa1-323 (NP_001344.2).
Format:: Supplied as a liquid.
Extra Details:: The human aldo-keto reductases 1C1 and 1C3 (AKR1C1 and AKR1C3) have major roles in pre receptor regulation of progesterone action. They can both convert progesterone to the less potent efficiencies. AKR1C1 and AKR1C3 also act as 3-ketosteroid reductase, and as such they can convert the most potent androgen 5alpha-DHT into 3beta-andorstandiol, which is an estrogen receptor beta ligand, and into the inactive androgen 3alpha-androstnionl, respectively. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.