123149-APC

AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3) (APC)

Size

£927.00

SKU:: 123149-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa111-211 from human C11orf17 (NP_065693) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: C11orf17 is a nuclear protein and known to bind to the amino terminus (residues 1-39) of the C subunit of PKA. It is a binding partner of NF-kappaB p65 subunit, and enhances NF-kappaB-mediated gene expression. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGATHVYRYHRGESKLHMCLDIGNGQRKDRKKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.