123135-ML650
AKAP13 (A-kinase Anchor Protein 13, AKAP-13, AKAP-Lbc, Breast Cancer Nuclear Receptor-binding Auxiliary Protein, Guanine Nucleotide Exchange Factor Lbc, Human Thyroid-anchoring Protein 31, Lymphoid Blast Crisis Oncogene, LBC Oncogene, Non-oncogenic Rho GTPase-specific GTP Exchange Factor, Protein Kinase A-anchoring Protein 13, PRKA13, p47, BRX, HT31, LBC) (MaxLight 650)
Size
£914.00
- SKU:
- 123135-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-111 from AKAP13 (NP_006729) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. AKAP13 functions as a protein kinase A (PKA)-anchoring protein and acts as an adapter protein to selectively couple G alpha-13 and Rho. It contains a dbl oncogene homology (DH) domain and a pleckstrin homology (PH) domain. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins. AKAP13 augments gene activation by the estrogen receptor and activates estrogen receptor beta by a p38 MAPK-dependent pathway. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice