123109-ML490
AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2) (MaxLight 490)
Size
£934.00
- SKU:
- 123109-ML490
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length recombinant protein corresponding to aa1-373 of human AIFM2.
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The p53 tumor suppressor protein induces cell cycle arrest or apoptosis in response to cellular stresses. PRG3 (p53-responsive gene 3), is induced specifically under p53-dependent apoptotic conditions in human colon cancer cells. PRG3 has significant homology to bacterial oxidoreductases and the apoptosis-inducing factor, AIF. Unlike AIF, PRG3 localizes in the cytoplasm and its ectopic expression induces apoptosis. The PRG3 gene is thus a novel p53 target gene in a p53-dependent apoptosis pathway. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice