123107
AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ14497, RP11-367H5.2)
Size
£685.00
- SKU:
- 123107
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human AIFM2, aa1-373 (NP_116186.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- The p53 tumor suppressor protein induces cell cycle arrest or apoptosis in response to cellular stresses. PRG3 (p53-responsive gene 3), is induced specifically under p53-dependent apoptotic conditions in human colon cancer cells. PRG3 has significant homology to bacterial oxidoreductases and the apoptosis-inducing factor, AIF. Unlike AIF, PRG3 localizes in the cytoplasm and its ectopic expression induces apoptosis. The PRG3 gene is thus a novel p53 target gene in a p53-dependent apoptosis pathway. Applications: Suitable for use in Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice