AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor)

Size

£685.00

SKU:: 123100
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-102 from human AHSP with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: AHSP (Alpha-hemoglobin stabilizing protein), also known as ERAF (Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of aplha-hemoglobin during normal erythroid cell development. It specifically protects free alpha-hemoglobin from precipitation in live cells and in solution. This protein is downregulated in transmissible spongiform encephalopathies (TSEs). It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Recombinant AHSP protein, expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice