123100-ML650
AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (MaxLight 650)
Size
£914.00
- SKU:
- 123100-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-102 from human AHSP with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. AHSP (Alpha-hemoglobin stabilizing protein), also known as ERAF (Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of aplha-hemoglobin during normal erythroid cell development. It specifically protects free alpha-hemoglobin from precipitation in live cells and in solution. This protein is downregulated in transmissible spongiform encephalopathies (TSEs). It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Recombinant AHSP protein, expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice