AHCYL1 (Putative Adenosylhomocysteinase 2, AdoHcyase 2, DC-expressed AHCY-like Molecule, S-adenosyl-L-homocysteine Hydrolase 2, S-adenosylhomocysteine Hydrolase-like Protein 1, DCAL, XPVKONA)

Size

£685.00

SKU:: 123083
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-101 from human AHCYL1 (NP_006612) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: S-adenosyl-L-homocysteine + H2O = L-homocysteine + adenosine. AHCY deficiency is one of the causes of hypermethioninemia, a rare disease affecting brain development and muscle strength. Down-regulation of AHCY is also associated with certain forms of cancer, Huntington's disease and Wilson's disease. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.