AGTPBP1 (CCP1, KIAA1035, NNA1, Cytosolic Carboxypeptidase 1, ATP/GTP-binding Protein 1, Nervous System Nuclear Protein Induced by Axotomy Protein 1 Homolog)

Size

£685.00

SKU:: 123075
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1087-1187 from AGTPBP1 (NP_056054) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.