AGR2 (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030)

Size

£685.00

SKU:: 123071
Purity:: Purified by affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant protein corresponding to aa1-175 from AGR2 (AAH15503) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Anterior gradient 2 (AGR2) is known as a cancer cell marker specifically up-regulated in response to depletion of serum and oxygen. AGR2 has been identified as a tumor marker in primary and secondary cancer lesions, and as a marker for detection of circulating tumor cells (CTCs). Elevated levels of AGR2 are known to increase the metastatic potential of cancer cells, but conditions leading to increased expression of AGR2 are not well understood. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.