123062-ML650
AGP1 (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, ORM1) (MaxLight 650)
Size
£934.00
- SKU:
- 123062-ML650
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human ORM1, aa1-201 (NP_000598.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. a1-Acid Glycoprotein (AGP; also OMD/Orosomucoid) is a 40-46kD member of the immunocalin subfamily, lipocalin family of molecules. In mouse, circulating AGP is principally the product of hepatocytes that originates from multiple related genes (AGP-1, -2 and -3 in Mus musculus). Circulating AGP-1 and -2 are both 189aa in length, the principal sources of protein, and show 83% aa identity; AGP-3 contributes little to the AGP pool. In mouse blood, AGP is normally 200-400ug/ml. In response to inflammatory mediators (IL-6; IL-1), its concentration will rise 2-10 fold. More importantly, a complex glycosylation pattern will also change, transitioning from modestly branched to highly branched oligosaccharides. This change is reflected in its bioactivity, which has been shown to be a function of carbohydrate branching. AGP is generally considered to be a suppressor of inflammation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice