ADAMTS17 (A Disintegrin and Metalloproteinase with Thrombospondin Motifs 17, ADAM-TS 17, ADAM-TS17, ADAMTS-17, FLJ16363, FLJ32769)

Size

£685.00

SKU:: 122980
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa543-651 from human ADAMTS17 (NP_620688) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ADAMTS17 is a Metallopeptidase M12B type protease. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.