122979-BIOTIN

ADAMTS13 (von Willebrand Factor-cleaving Protease, vWF-cleaving Protease, vWF-CP, A Disintegrin And Metalloproteinase With Thrombospondin Motifs 13, ADAMTS-13, ADAM-TS 13, ADAM-TS13, UNQ6102/PRO20085, C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900) (Biotin)

Size

£927.00

SKU:: 122979-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1328-1427 from human ADAMTS13 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F12
Format:: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
Extra Details:: ADAMTS13 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice