122971-PE

ADAM20 (Disintegrin and Metalloproteinase Domain-containing Protein 20, ADAM 20) (PE)

Size

£914.00

SKU:: 122971-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa268-359 from human ADAM20 (NP_003805) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: ADAM20 is a Metallopeptidase M12B type protease. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.