ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein)

Size

£685.00

SKU:: 122930
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa543-639 from human ACTN1 (NP_001093) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ACTN1 is a F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.