122903-HRP

ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase 2, LACS 2, LACS2, Palmitoyl-CoA Ligase 1, Palmitoyl-CoA Ligase 2) (HRP)

Size

£914.00

SKU:: 122903-HRP
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Extra Details:: Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular localizations. Overexpression of ACSL1 results in changes of fatty acid metabolism in rat primary hepatocytes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice