ACP1 (Low Molecular Weight Phosphotyrosine Protein Phosphatase, LMW-PTP, LMW-PTPase, Low Molecular Weight Cytosolic Acid Phosphatase, Red Cell Acid Phosphatase 1, PTPase, Adipocyte Acid Phosphatase)

Size

£685.00

SKU:: 122893
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-158 from human ACP1 (AAH07422) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.