122890-HRP
ACOX2 (Acyl-Coenzyme A Oxidase 2, Branched Chain, BCOX, BRCACOX, BRCOX, THCCox, Peroxisomal Branched Chain Acyl-CoA Oxidase, THCA-CoA Oxidase, Trihydroxycoprostanoyl-CoA Oxidase) (HRP)
Size
£914.00
- SKU:
- 122890-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa582-682 from ACOX2 (NP_003491) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- ACOX2 belongs to the acyl-CoA oxidases family. It is a branched-chain acyl-CoA oxidase, and is involved in the degradation of long branched fatty acids and bile acid intermediates in peroxisomes. It oxidizes the CoA esters of the bile acid intermediates di- and tri-hydroxycholestanoic acids. Mutations resulting in the deficiency of ACOX2 lead to the accumulation of branched fatty acids and bile acid intermediates. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQENPAYEEYIRPLLQSWRSKL* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice