ACOT8 (ACTEIII, PTE1, PTE2, Acyl-coenzyme A Thioesterase 8, Acyl-CoA Thioesterase 8, Choloyl-coenzyme A Thioesterase, HIV-Nef-associated Acyl-CoA Thioesterase, PTE-2, Peroxisomal Acyl-coenzyme A Thioester Hydrolase 1, Peroxisomal Long-chain Acyl-CoA Thioesterase 1, Thioesterase II)

Size

£685.00

SKU:: 122883
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length protein corresponding to aa1-319 from human ACOT8 (NP_005460.2).
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. It may mediate Nef-induced down-regulation of CD4. It may be involved in the metabolic regulation of peroxisome proliferation. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.