ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, GCP60)

Size

£685.00

SKU:: 122864
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa73-172 from human ACBD3 (NP_073572) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.