122856-ML490
ACAP2 (Arf-GAP with Coiled-coil, ANK Repeat and PH Domain-containing Protein 2, Centaurin-beta-2, Cnt-b2, CENTB2, KIAA0041) (MaxLight 490)
Size
£914.00
- SKU:
- 122856-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa473-582 from CENTB2 (NP_036419) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DVINRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVS* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice