ACADVL (Acyl Coenzyme A Dehydrogenase Very Long Chain, Acyl-CoA Dehydrogenase Very Long Chain, ACAD6, LCACD, Very Long-chain Specific Acyl-CoA Dehydrogenase Mitochondrial, VLCAD)

Size

£685.00

SKU:: 122853
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa345-434 from human ACADVL (NP_000009) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in its gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.