ABTB1 (BPOZ, Ankyrin Repeat and BTB/POZ Domain-containing Protein 1, Elongation Factor 1A-binding Protein, MGC20585, PP2259)

Size

£685.00

SKU:: 122837
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa271-371 from human ABTB1 (NP_742024) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May act as a mediator of the PTEN growth-suppressive signaling pathway. May play a role in developmental processes. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.