ABLIM1 (Actin-binding LIM Protein 1, abLIM-1, Actin-binding LIM Protein Family Member 1, Actin-binding Double Zinc Finger Protein, LIMAB1, Limatin, ABLIM, KIAA0059, DKFZp781D0148, FLJ14564, MGC1224)

Size

£685.00

SKU:: 122831
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa637-736 from human ABLIM1 (NP_002304) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: May act as scaffold protein. May play a role in the development of the retina. Has been suggested to play a role in axon guidance. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.