122829-BIOTIN

ABL2 (Tyrosine-protein Kinase ABL2, Abelson Murine Leukemia Viral Oncogene Homolog 2, Abelson-related Gene Protein, Tyrosine Kinase ARG, ABLL, ARG) (Biotin)

Size

£927.00

SKU:: 122829-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa743-842 from human ABL2 (AAH65912) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6D5
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: ABL2 is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. ABL2 is expressed in both normal and tumor cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.