ABCA1 (ATP-binding Cassette Sub-family A Member 1, ATP-binding Cassette Transporter 1, ABC-1, ATP-binding Cassette 1, Cholesterol Efflux Regulatory Protein, ABC1, CERP)

Size

£698.00

SKU:: 122792
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa86-185 from human ABCA1 with GST tag (NP_005493). MW of the GST tag alone is 26kD.
Clone:: 1H4
Format:: Supplied as a liquid.
Extra Details:: Mutations in the ABCA1 gene (ATP-binding cassette transporter 1) have been reported in Tangier disease (TD). TD is an autosomal recessive disorder characterized by an absence of plasma HDL, cholesterol ester depositing in the reticulo-endothelial system and deviations in cellular lipid trafficking. ABCA1 mediates the apo-A1 associated export of cholesterol and phospholipids from the cell. It is expressed on the plasma membrane and the Golgi complex, and is regulated by cholesterol flux. Regulation of the cholesterol flux between HDL and macrophages is competitive between ABCA1 and SR-BI. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.