059501
Gastric Inhibitory Polypeptide Receptor, Recombinant, Cynomolgus Monkey, aa26-138, His-Tag, Active
Size
£563.00
- SKU:
- 059501
- Molecular Weight:
- 14.5
- Purity:
- ≥95% (SDS-PAGE). Endotoxin: ≤1EU/ug (LAL).
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Format:
- Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 250mM Imidazole, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
- Extra Details:
- GIPR mediates the insulinotropic effects of glucose-dependent insulinotropic polypeptide and represents a validated target in metabolic disease research, yet reliable extracellular domain constructs for antibody screening remain scarce. This yeast-expressed fragment spanning residues 26–138 captures the N-terminal ligand-binding region and demonstrates quantifiable antibody recognition in functional ELISA, binding an anti-GIPR recombinant antibody (059499) with an EC50 of 12.66–13.86ng/ml—a result that supports its use in therapeutic antibody epitope mapping, competitive inhibition assays, and blocking antibody screening campaigns. Partial recombinant protein corresponding to aa26-138 from Cynomolgus monkey Gastric inhibitory polypeptide receptor, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/Uniprot: A0A2K5VD75 Molecular Weight: ~14.5kD Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis GIPR (059501) at 2ug/ml can bind Anti-GIPR recombinant antibody (059501). The EC50 is 12.66-13.86ng/ml. Amino Acid Sequence: GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice