Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag, Active

Size

£473.00

SKU:: 059500
Molecular Weight:: 16.2
Purity:: ≥95% (SDS-PAGE, SEC-HPLC). Endotoxin: ≤1EU/ug (LAL).
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: GIPR, a class B G protein-coupled receptor, mediates glucose-dependent insulinotropic polypeptide signaling and represents a therapeutic target in metabolic disease research. This mammalian-expressed fragment spanning residues 22–138 captures the extracellular ligand-binding domain, where native glycosylation and disulfide bonding are critical for antibody recognition and ligand interaction studies. Provides a suitable basis for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and blocking antibody validation in drug discovery workflows targeting incretin receptor pathways. Partial recombinant protein corresponding to aa22-138 from human Gastric inhibitory polypeptide receptor, fused 10X His-Tag at C-terminal, expressed in Mammalian cell. Swiss/Uniprot: P48546 Molecular Weight: ~16.2kD Biological Activity: Specific binding to an anti-GIPR recombinant antibody (059499) with an EC50 of 16.18–18.7ng/ml, confirming that the protein retains conformational epitopes required for therapeutic antibody screening, competitive inhibition assays, and epitope mapping experiments. Amino Acid Sequence: RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ Subcellular Location: Cell membrane; Multi-pass membrane protein. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Shipping Conditions:: Blue Ice