Mite allergen Der p 3, Recombinant, Dermatophagoides pteronyssinus, aa30-261, His-Tag

Size

£633.00

SKU:: 058635
Molecular Weight:: 27
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 10mM Tris-HCl, 1mM EDTA, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml
Extra Details:: Full-length recombinant protein corresponding to aa30-261 from Dermatophagoides pteronyssinus Mite allergen Der p 3, fused to 6X His-Tag at N-terminal, expressed in yeast. Swiss/Uniprot: P39675 Molecular Weight: ~27kD Amino Acid Sequence: IVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.