Titin (TTN), Recombinant, Mouse, His-Tag

Size

£380.00

SKU:: 051300
Application:: WB
Molecular Weight:: 30
Purity:: ≥90%
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder in PBS, pH 7.4, 0.01% SKL, 5% trehalose. Reconstitute with sterile 10mM PBS, pH 7.4 to 0.1-1mg/ml. Do not vortex.
Extra Details:: Recombinant protein corresponding to aa34750-34990 with an N-Terminal His Tag from mouse Titin, expressed in E. coli. Uniprot/Accession: A2ASS6 Predicted Isoelectric Point: 5.3 Predicted Molecular Weight: 30kD Accurate Molecular Weight: 33kD as determined by SDS-PAGE reducing conditions Subcellular Location: Nucleus, Cytoplasm Amino Acid Sequence: TSQKKASAQEEISQKALTSEEIKMSEVKSHETLAIKEEASKVLIAEEVKRSAAASLEKSIVHEEVTKTSQASEEVKTHAEIKTLSTQMNITKGQRATLKANIAGATDVKWVLNGTELPNSEEYRYGVSGSDQTLTIKQASHREEGILSCIGKTSQGVVKCQFDLTLSEELSDAPSFITQPRSQNINEGQNLFSCEVSGEPSEIEWFKNNLPISISSNISVSRSRNVYTLEIRNAAVSDS Applications: Suitable for use in ELISA, Western Blot and SDS-PAGE. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.