Myelin Basic Protein (MBP)

Size

£544.00

SKU:: 031393
Purity:: Purified by immunoaffinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence
Clone:: 7D2
Format:: Supplied as a liquid in PBS, 5mM sodium azide, 50% glycerol.
Extra Details:: Myelin Basic Protein (MBP) is one of the major proteins of the myelin sheath surrounding axons in the nervous system. Since it is of relatively low molecular weight and high abundance the protein sequence was determined from purified protein over 30 years ago (1). The protein is made by oligodendrocytes in the central nervous system, so antibodies to MBP are good markers of this cell type. However, transcripts from the same gene are also expressed in certain hematopoetic lineage cells (2). In the mammalian central nervous system there are four different forms of the protein made by alternate transcription from a single gene, which have molecular weights of 21.5, 20.5, 18.5, and 17.2kD in humans. The single gene of rodents also produces 4 different proteins, but of slightly different sizes, 21.5, 18.5, 17 and 14kD. Sequence alignments of both sets of isotypes can be downloaded from here. We characterized our antibodies on rat spinal cord homogenates and detected the four bands expected for that species. As shown below, 031393 shows preferential binding for the two higher molecular weight isoforms of 21.5kD and 18.5kD in the rat. The HGNC name for this protein is MBP. Applications: Suitable for use in Western Blot, Immunohistochemistry, Immunofluorescence and Immunocytochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence (IC): 1:2000-1:5000 Western Blot: 1::5000-1:10,000 Immunohistochemistry (paraffin): 1:10,000 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice