PN-120
WaTx

Size
£248.00
- SKU:
- PN-120
- Additional Names:
- Wasabi receptor toxin|WaTx, WaTx, wasabi receptor toxin, venom, black rock scorpion Urodacus manicous, transient receptor potential cation channel 1, TRPA1, pain , H-ASPQQAKYC*YEQC*NVNKVPFDQC*YQMC*SPLERS-OH (disulphide bridge between C 9 and C 27 and C 13 and C23, ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS, PN-120, PN120
- Purity:
- >95%
- Supplier:
- Isca Biochemicals
- Sequence:
- H-Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser-OH (disulphide bridge between C9 and C27 and C13 and C23)
- Shipping Conditions:
- Blue Ice
