ARG59650
anti-HOXB5 antibody
Size
£429.00
- SKU:
- ARG59650
- Additional Names:
- homeobox B5
- Application:
- IHC-P
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 29 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human HOXB5. (within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN)
- Synonyms:
- Homeobox protein Hu-1; HOX2; HOX2A; HHO.C10; HU-1; Homeobox protein Hox-B5; Homeobox protein HHO.C10; Hox2.1; Homeobox protein Hox-2A
- Gene Details:
- 3215
- Shipping Conditions:
- Blue Ice