ARG59649
anti-HCFC1R1 antibody
Size
£429.00
- SKU:
- ARG59649
- Additional Names:
- host cell factor C1 regulator 1 (XPO1 dependent)
- Application:
- WB
- Concentration:
- Batch dependent: 0.5 - 1
- Molecular Weight:
- 15 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Porcine, Rat, Caprine, Equine
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the middle region of Human HCFC1R1. (within the following region: LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM)
- Synonyms:
- HCF-1 beta-propeller-interacting protein; Host cell factor C1 regulator 1; HPIP
- Gene Details:
- 54985
- Shipping Conditions:
- Blue Ice