ARG59543
anti-GRK2 antibody
Size
£408.00
- SKU:
- ARG59543
- Additional Names:
- adrenergic, beta, receptor kinase 1
- Application:
- Flow Cytometry, WB, IHC-P, IF, ICC
- Concentration:
- 0.5
- Molecular Weight:
- 80 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human GRK2. (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK)
- Synonyms:
- BETA-ARK1; Beta-adrenergic receptor kinase 1; GRK2; BARK1; EC 2.7.11.15; Beta-ARK-1; G-protein coupled receptor kinase 2
- Gene Details:
- 156
- Shipping Conditions:
- Blue Ice




