ARG59484
anti-UHRF2 / NIRF antibody
Size
£429.00
- SKU:
- ARG59484
- Additional Names:
- ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase
- Application:
- WB
- Molecular Weight:
- 90 kDa
- Purification:
- Affinity purified.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Bovine, Canine, Human, Mouse, Rabbit, Rat, Equine, Guinea Pig
- Buffer:
- PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
- Immunogen:
- Synthetic peptide around the N-terminal region of Human UHRF2 / NIRF. (within the following region: TNKLDSVPSTSNSDCVAADEDVIYHIQYDEYPESGTLEMNVKDLRPRART)
- Synonyms:
- Nuclear zinc finger protein Np97; EC 6.3.2.-; Ubiquitin-like PHD and RING finger domain-containing protein 2; RING finger protein 107; Nuclear protein 97; Np95-like RING finger protein; RNF107; NIRF; URF2; Np95/ICBP90-like RING finger protein; Ubiquitin-like-containing PHD and RING finger domains protein 2; E3 ubiquitin-protein ligase UHRF2
- Gene Details:
- 115426
- Shipping Conditions:
- Blue Ice