ARG59309
anti-FBXL11 antibody
Size
£408.00
- SKU:
- ARG59309
- Additional Names:
- lysine (K)-specific demethylase 2A
- Application:
- WB
- Concentration:
- 0.5
- Molecular Weight:
- 133 kDa
- Purification:
- Affinity purification with immunogen.
- Storage Conditions:
- For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
- Supplier:
- Arigo Biolaboratories
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Buffer:
- 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
- Immunogen:
- Synthetic peptide corresponding to a sequence of Human FBXL11. (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR).
- Synonyms:
- CXXC-type zinc finger protein 8; CXXC8; EC 1.14.11.27; LILINA; FBL7; Lysine-specific demethylase 2A; [Histone-H3]-lysine-36 demethylase 1A; FBXL11; JmjC domain-containing histone demethylation protein 1A; JHDM1A; F-box/LRR-repeat protein 11; F-box protein Lilina; F-box protein FBL7; F-box and leucine-rich repeat protein 11; FBL11
- Gene Details:
- 22992
- Shipping Conditions:
- Blue Ice